PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G214700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 316aa    MW: 33465.5 Da    PI: 8.0145
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G214700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191156147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        rg+W++eEd+ l ++v+++G ++W++I r+++ gR++k+c++rw + 
  Sevir.4G214700.1.p 11 RGPWSPEEDDALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 56
                        89******************************.***********985 PP

2Myb_DNA-binding55.11.8e-1763105145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         r ++T+eEd  +v+a+++lG++ W++Iar ++ gRt++ +k++w+
  Sevir.4G214700.1.p  63 RRPFTAEEDAAIVRAHARLGNR-WAAIARLLP-GRTDNAVKNHWN 105
                         679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.62661IPR017930Myb domain
SuperFamilySSF466893.71E-318104IPR009057Homeodomain-like
SMARTSM007175.3E-171059IPR001005SANT/Myb domain
PfamPF002491.5E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-251264IPR009057Homeodomain-like
CDDcd001672.97E-161355No hitNo description
SMARTSM007175.3E-1662110IPR001005SANT/Myb domain
PROSITE profilePS5129420.28663112IPR017930Myb domain
PfamPF002498.9E-1563105IPR001005SANT/Myb domain
CDDcd001671.29E-1265105No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2365112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGAEAECDRI RGPWSPEEDD ALRRLVERHG ARNWTAIGRE IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTAEE DAAIVRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNCSLKR KLAAATAASG  120
AVAGAGADEF DARPCKRVSL SPDSPSSGSG TVSDRSDLSH GPGAGSGSGS GQIYRPVPRS  180
GGFEPADCAM SRPVEDDDPL TSLSLSLPGT DQRFHHDRAH SQFQELPPSP SPPSPSPPPP  240
PAPVAATATS PYPFNPDFMA VMQELIRTEV QRYMASVGVR AGCGPAGGAE LCMPQLVEGV  300
MRAAAERVGA VGRIQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-4081124108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794291e-150HF679429.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB23 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965791.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW18e-68MYB44_ARATH; Transcription factor MYB44
TrEMBLK3XYD00.0K3XYD0_SETIT; Uncharacterized protein
STRINGSi006938m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-56myb domain protein r1